Cardarine comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2025-10-10. Numbers and descriptions here follow the published literature rather than marketing material.
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
In the fitness and bodybuilding literature, cardarine is frequently discussed as an endurance agent or fat-loss compound, although such claims are not supported by robust clinical evidence. Online descriptions often mix animal data, user anecdotes, and marketing language. Researchers who study PPARδ agonists distinguish between receptor activation in controlled experiments and unsupervised use of unverified products. The latter introduces unknown purity, dose, and interactions, making reported experiences difficult to interpret scientifically.
| Property | Value | Notes |
|---|---|---|
| CAS Registry Number | 317318-70-0 | Unique identifier for the compound. |
| Chemical class | PPARδ agonist | Synthetic ligand for peroxisome proliferator-activated receptor delta. |
| Appearance | White to off-white solid | Typical form of research-grade material. |
| Solubility | Soluble in DMSO and ethanol | Poorly soluble in water. |
| Typical storage | -20°C | Recommended for long-term storage of stock solutions. |
Regulatory bodies treat GW501516 as a prohibited substance in competitive sport. The World Anti-Doping Agency added it to the prohibited list, and it falls under classes covering metabolic modulators and hormone-related agents. It is not approved by drug regulators for human use, and it is not a lawful dietary supplement. Products sold under the cardarine name may contain unlisted ingredients or different compounds. Because no approved product exists, quality and identity are not guaranteed by pharmaceutical manufacturing standards.
Cardarine is a common name for the investigational chemical GW501516, also written GW-1516. It was developed as a peroxisome proliferator-activated receptor delta agonist for metabolic conditions such as dyslipidemia. Early research focused on lipid handling and energy use in skeletal muscle and other tissues. The compound was never approved as a medicine. In public discussion, it is often grouped with performance-enhancing substances, although its receptor target differs from that of anabolic steroids or selective androgen receptor modulators. Regulatory and health authorities have issued warnings about its use.
Safety concerns emerged from long-term animal studies. In rodents given the compound for extended periods, researchers found an increased incidence of certain cancers, including liver and bladder tumors. These findings contributed to the discontinuation of clinical development. Whether similar risks apply to short-term or low-level exposure in humans is not established, and controlled human safety data are limited. The relevance of high-dose rodent carcinogenicity findings to human use remains a subject of debate.
Human trials of GW501516 were small and short in duration. They examined lipid levels, glucose handling, and other metabolic markers, but the programs were halted after the animal cancer findings. No approved therapeutic product exists, and published human data are insufficient for establishing long-term safety. Reports of use for athletic performance come mainly from non-clinical settings and cannot be verified through controlled trials. Independent testing of products sold as cardarine has found inconsistent purity and labeling.
GW501516 binds and activates PPARδ, a nuclear receptor that influences transcription of genes involved in fatty acid oxidation and energy use. Activation shifts some metabolic pathways in preclinical models, which is why the compound has been studied for lipid disorders and exercise-related endpoints. The exact downstream effects in humans are incompletely mapped. PPARδ is expressed in many tissues, including skeletal muscle, liver, and adipose tissue, so broad activation may have varied consequences. Researchers continue to examine how selective or partial activation might alter the balance between benefits and risks.
Published human data are sparse and mostly come from early-phase trials. Those studies examined short-term changes in lipids, glucose, and exercise capacity, but they were not large enough to establish efficacy or long-term safety. Some animal experiments reported increased running endurance, yet such findings do not prove a performance benefit in people. Anti-doping laboratories detect GW501516 and its metabolites in urine or blood using liquid chromatography-tandem mass spectrometry. Detection windows depend on dose, sample type, and individual metabolism. The method is sensitive enough to identify trace residues in tested samples.
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
Cardarine is the common name for GW501516, a synthetic compound studied as a peroxisome proliferator-activated receptor delta agonist. Researchers developed it to explore treatments for lipid disorders and metabolic conditions. It is not an approved medicine in any country. Early clinical work examined changes in HDL cholesterol and triglycerides, but development was discontinued after animal studies raised concerns about cancer. The compound remains available as a research chemical and appears in discussions of performance enhancement.
==== Trypanosome resistance ==== After its introduction to the market in the 1980s, eflornithine has replaced melarsoprol as the first line medication against Human African trypanosomiasis (HAT) due to its reduced toxicity to the host. Trypanosoma brucei resistant to eflornithine was reported as early as the mid-1980s. The gene TbAAT6, conserved in the genome of Trypanosomes, is believed to be responsible for the transmembrane transporter that brings eflornithine into the cell. The loss of this gene due to specific mutations causes resistance to eflornithine in several trypanosomes. If eflornithine is prescribed to a patient with Human African trypanosomiasis caused by a trypanosome that contains a mutated or ineffective TbAAT6 gene, then the medication will be ineffective against the disease. Resistance to eflornithine has increased the use of melarsoprol despite its toxicity, which has been linked to the deaths of 5% of recipient HAT patients.
Xylose reductase catalyses the initial reaction in the xylose utilization pathway. The enzyme can use nicotinamide adenine dinucleotide (NADH) or nicotinamide adenine dinucleotide phosphate (NADPH) as its cofactor.
Their southernmost settlements being around Schwansen, Hedeby and Husum, mirroring the same southern border as their Angle predecessors. As raiding was a frequent practice among the Danes, Saxons, and Wagrians, the borderlands was a hostile and unsafe area to inhabit. In response to these threats, the Danes began constructing the Danevirke. Originally built as a dyke, it was gradually expanded into a 30-kilometer earthwork with a palisade fortification, forming a barrier between the Danes and their southern neighbors. The Danevirke was strategically positioned at the narrowest point of the peninsula, with its eastern end beginning at the Treene River and extending to the Schlei Bay. This fortification served to deter Saxon and Wagrian raids while enabling the Danes to launch their own raids into southern territories. It would remain in use until 1864, being expanded and adapted to the changing military needs of the Danes multiple times. The establishment of the Danevirke not only helped to prevent Saxon and Wagrian raids into Danish territory but also served as a toll station. Danish chieftains would collect fees from traders, merchants, and peasants traveling along the Hærvejen (Heerweg/Armyway), the main trade route running through the peninsula. Saxons, Wagrians, and Danes alike used the Hærvejen to trade goods such as honey, furs, amber, glass, metalwork, and other commodities, such as livestock, with cattle and oxen being particularly important.
==== March 2008 hepatitis ==== In March and April 2008, the Community Epidemiology Branch of the San Diego County Health and Human Services Agency traced a hepatitis A outbreak in San Diego County to a single Chipotle restaurant located in La Mesa, California, in which 22 customers were infected with the virus.
Sources: en.wikipedia.org
Mike Harrington (born 1964) is an American programmer and businessman. With Gabe Newell, he is the co-founder of the video game company Valve. After the success of the first Valve game, Half-Life (1998), Harrington left Valve in 2000. In 2005, he co-founded the photo editing service Picnik.
Notch is a cell surface protein that functions as a receptor. Animals have a small set of genes that code for signaling proteins that interact specifically with Notch receptors and stimulate a response in cells that express Notch on their surface. Molecules that activate (or, in some cases, inhibit) receptors can be classified as hormones, neurotransmitters, cytokines, and growth factors, in general called receptor ligands. Ligand receptor interactions such as that of the Notch receptor interaction, are known to be the main interactions responsible for cell signaling mechanisms and communication. Notch acts as a receptor for ligands that are expressed on adjacent cells. While some receptors are cell-surface proteins, others are found inside cells. For example, estrogen is a hydrophobic molecule that can pass through the lipid bilayer of the membranes. As part of the endocrine system, intracellular estrogen receptors from a variety of cell types (such as ovary, prostate, lung, cardiovascular and central nervous systems) can be activated by estrogen produced in the ovaries. In the case of Notch-mediated signaling, the signal transduction mechanism can be relatively simple. As shown in Figure 2, the activation of Notch can cause the Notch protein to be altered by a protease. Part of the Notch protein is released from the cell surface membrane and takes part in gene regulation. Cell signaling research involves studying the spatial and temporal dynamics of both receptors and the components of signaling pathways that are activated by receptors in various cell types.
== Mathematical work == Abel's work on elliptic functions was built on Legendre's, and some of Gauss's work in statistics and number theory completed that of Legendre. He developed, and first communicated to his contemporaries before Gauss, the least squares method which has broad application in linear regression, signal processing, statistics, and curve fitting; this was published in 1806 as an appendix to his book on the paths of comets. Today, the term "least squares method" is used as a direct translation from the French "méthode des moindres carrés". His major work is Exercices de Calcul Intégral, published in three volumes in 1811, 1817 and 1819. In the first volume he introduced the basic properties of elliptic integrals, beta functions and gamma functions, introducing the symbol Γ and normalizing it to Γ(n+1) = n!. Further results on the beta and gamma functions along with their applications to mechanics – such as the rotation of the earth, and the attraction of ellipsoids – appeared in the second volume. In 1830, he gave a proof of Fermat's Last Theorem for exponent n = 5, which was also proven by Lejeune Dirichlet in 1828. In number theory, he conjectured the quadratic reciprocity law, subsequently proved by Gauss; in connection to this, the Legendre symbol is named after him. He also did pioneering work on the distribution of primes, and on the application of analysis to number theory. His 1798 conjecture of the prime number theorem was rigorously proved by Hadamard and de la Vallée-Poussin in 1896.
=== Agonists === Non-selective Galanin Galanin 1-15 fragment Galanin-like peptide - agonist at GAL1 and GAL2 but not GAL3 Galmic Galnon NAX 5055 D-Gal(7-Ahp)-B2 GAL1 selective M617 GAL1/2 selective M1154 - has no GalR3 interaction GAL2 selective Galanin 2-11 amide - also called AR-M 1896, anticonvulsant in mice, CAS# 367518–31–8 M1145 - selective compared to both GalR1 and GalR3 M1153 - selective compared to both GalR1 and GalR3 CYM 2503 (positive allosteric modulator)
=== Entrepreneurship and biotechnology investing === Springer co-founded biotechnology companies Scholar Rock in 2012, Morphic Therapeutic in 2015, Tectonic Therapeutic in 2019, and Seismic Therapeutic in 2022. He was also an early investor in Selecta Biosciences and Editas Medicine. Springer was a founding investor of Moderna after investing USD$5 million in 2010. He was the company's fourth-largest shareholder and made USD$400 million when the company launched its initial public offering (IPO) in 2018. During the COVID-19 pandemic, Forbes estimated Springer's net worth as USD$1 billion after in share price of biotechnology companies surged.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
=== Pregnancy === The research into the safety of benzodiazepines during pregnancy is limited and it is recommended that use of benzodiazepines during pregnancy should be based on whether the benefits outweigh the risks. If chlordiazepoxide is used during pregnancy, the risks can be reduced via using the lowest effective dose and for the shortest time possible. Benzodiazepines should generally be avoided during the first trimester of pregnancy. Chlordiazepoxide and diazepam are considered to be among the safer benzodiazepines to use during pregnancy in comparison to other benzodiazepines. Possible adverse effects from benzodiazepine use during pregnancy include miscarriage, malformation, intrauterine growth retardation, functional deficits, carcinogenesis and mutagenesis. Caution is also advised during breast feeding as chlordiazepoxide passes into breast milk.
The long-acting insulin class, which includes insulin glargine, do not appear much better than neutral protamine Hagedorn (NPH) insulin, but do have a greater cost, making them, as of 2010, not cost effective for the treatment of type 2 diabetes. In a previous review it was unclear if there is a difference in hypoglycemia, as there was not enough data to determine any differences with respect to long term outcomes, however a more recent Cochrane systematic review did not find clinically significant difference when comparing insulin glargine to NPH insulin, insulin detemir or insulin degludec in the management of type 1 diabetes in either adults or children over periods of 6 months or longer. It is not typically the recommended long-acting insulin in the United Kingdom. Semglee is indicated to improve glycemic control in adults and children with type 1 diabetes and in adults with type 2 diabetes. Semglee is both biosimilar to, and interchangeable with, its reference product Lantus (insulin glargine), a long-acting insulin analog.
The report stated that "continued destruction which came after the ceasefire agreement was not justifiable by any means" and noted that since "extended Russian military action reaching out into Georgia was conducted in violation of international law, Georgian military forces were acting in legitimate self-defence under Article 51 of the UN Charter." Although further Russian military advances into the Georgian territories were explained by the Russian authorities as necessitated to avert possible Georgian counter-attacks from the Gori Municipality and to avert "imminent Georgian attack on Abkhazia", the commission noted that "The Georgian armed forces were hardly ever able to conduct military operations on two fronts at the same time", and "In practical terms, there were no Georgian combat troops in western Georgia when the Russian operation there started". The commission noted, "Georgia did not use force against Russian troops on Russian territory, but only on Georgian territory." The commission stated that an attack by Georgian troops on Russian peacekeepers present in Georgia – "if not in self-defence against a Russian attack", would not be justified. The commission wrote that it was "not entirely clear that Georgian military action against the base was aimed specifically at Russia".
Sources: en.wikipedia.org
Cardarine is a common name for GW501516, a synthetic PPARδ agonist developed for research. It has not been approved as a medication in any country. It is classified as an unapproved drug and a prohibited substance in sport.
No. Cardarine is not an anabolic steroid; it belongs to a different chemical class that targets PPARδ. Steroids act primarily through androgen receptors, while cardarine acts through a nuclear receptor involved in metabolism.
Some rodent studies reported increased endurance and changes in fat metabolism after cardarine exposure. Long-term studies in animals also raised concerns about cancer in certain tissues. Human trial data are limited, so these findings cannot be directly translated to people.
It binds and activates PPARδ, a nuclear receptor that influences gene expression related to fatty acid metabolism and energy balance. This mechanism has been studied mainly in animals and cell models, not established as a safe human therapy.